Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uhmk1 Peptide - C-terminal region

Uhmk1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4732477C12Rik, 4930500M09Rik, AA673513, AI449218, AU021979, KIS, Kist

UniProt

P97343

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uhmk1 Rabbit Polyclonal Antibody (orb330157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034763

Preservative

Lyophilized powder

AA Sequence

DDDYLENEDEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1404 (NM_001000787) Rat Tagged Lenti ORF Clone
RR205773L4 10 µg

Olr1404 (NM_001000787) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C4BPB (NM_001017367) Human Recombinant Protein
TP319216 20 µg

C4BPB (NM_001017367) Human Recombinant Protein

Sign In for Pricing
View Details
LSAMP Protein Vector (Mouse) (pPB-C-His)
PV197962 500 ng

LSAMP Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
WDR54 Antibody
C41876-01 40 µL

WDR54 Antibody

Sign In for Pricing
View Details
WDR54 Antibody
C41876-02 100 µL

WDR54 Antibody

Sign In for Pricing
View Details
WDR54 Antibody
C41876-03 200 µL

WDR54 Antibody

Sign In for Pricing
View Details