Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uhrf2 Peptide - N-terminal region

Uhrf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310065A22Rik, AI426270, AW214556, D130071B19Rik, Nirf

UniProt

Q7TMI3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uhrf2 Rabbit Polyclonal Antibody (orb575257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659122

Preservative

Lyophilized powder

AA Sequence

TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Aminopentan-2-ol
TRC-A226241-100MG 100 mg

3-Aminopentan-2-ol

Sign In for Pricing
View Details
PKM2 (PKM) Rabbit Polyclonal Antibody
TA379984 100 µL

PKM2 (PKM) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DUT (NM_001948) Human Over-expression Lysate
LC400715 20 µg

DUT (NM_001948) Human Over-expression Lysate

Sign In for Pricing
View Details
ADCY4 Antibody
8C12034-AAT 50 µg

ADCY4 Antibody

Sign In for Pricing
View Details
Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit
RDR-COL1a2-Mu-01 96 Tests

Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details
Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit
RDR-COL1a2-Mu-02 48 Tests

Mouse Collagen Type I Alpha 2 (COL1a2) ELISA Kit

Sign In for Pricing
View Details