Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uhrf2 Peptide - N-terminal region

Uhrf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310065A22Rik, AI426270, AW214556, D130071B19Rik, Nirf

UniProt

Q7TMI3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uhrf2 Rabbit Polyclonal Antibody (orb575257) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659122

Preservative

Lyophilized powder

AA Sequence

TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Oleate
TRC-E925325-5G 5 g

Ethyl Oleate

Sign In for Pricing
View Details
4931406B18Rik Mouse Gene Knockout Kit (CRISPR)
KN500412 1 Kit

4931406B18Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS S1 protein, His Tag (MALS verified)
S1N-S52H5-100ug 100 µg

SARS S1 protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Human ASCC2 activation kit by CRISPRa
GA113401 1 Kit

Human ASCC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Formic Acid-13C
TRC-F692902-50MG 50 mg

Formic Acid-13C

Sign In for Pricing
View Details
Recombinant Human GNMT Protein (His Tag)
PKSH032498-01 10 µg

Recombinant Human GNMT Protein (His Tag)

Sign In for Pricing
View Details