Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ULK3 Peptide - middle region

ULK3 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp434C131, FLJ90566

UniProt

Q6PHR2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ULK3 Rabbit Polyclonal Antibody (orb584182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092906

Preservative

Lyophilized powder

AA Sequence

LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human RPS27 Polyclonal Antibody
HC735014-01 50 µg

Anti-Human RPS27 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human RPS27 Polyclonal Antibody
HC735014-02 100 µg

Anti-Human RPS27 Polyclonal Antibody

Sign In for Pricing
View Details
BRMS-1 Polyclonal Antibody
MBS9245775-01 0.1 mL

BRMS-1 Polyclonal Antibody

Sign In for Pricing
View Details
BRMS-1 Polyclonal Antibody
MBS9245775-02 5x 0.1 mL

BRMS-1 Polyclonal Antibody

Sign In for Pricing
View Details
PRR11 rabbit pAb
RA30889-01 50 µL

PRR11 rabbit pAb

Sign In for Pricing
View Details
PRR11 rabbit pAb
RA30889-02 100 µL

PRR11 rabbit pAb

Sign In for Pricing
View Details