Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNG Peptide - C-terminal region

UNG Peptide - C-terminal region

Product Specifications

Product Name Alternative

DGU, DKFZp781L1143, HIGM4, UDG, UNG1, UNG15, UNG2

UniProt

P13051

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UNG Rabbit Polyclonal Antibody (orb584931) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_550433

Preservative

Lyophilized powder

AA Sequence

GWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842S-01 20 Tests

Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842S-02 100 Tests

Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09842S-03 2x 100 Tests

Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
DCX Polyclonal Antibody
E-AB-19408-01 20 µL

DCX Polyclonal Antibody

Sign In for Pricing
View Details
DCX Polyclonal Antibody
E-AB-19408-02 60 µL

DCX Polyclonal Antibody

Sign In for Pricing
View Details
DCX Polyclonal Antibody
E-AB-19408-03 120 µL

DCX Polyclonal Antibody

Sign In for Pricing
View Details