Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNG Peptide - C-terminal region

UNG Peptide - C-terminal region

Product Specifications

Product Name Alternative

DGU, DKFZp781L1143, HIGM4, UDG, UNG1, UNG15, UNG2

UniProt

P13051

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UNG Rabbit Polyclonal Antibody (orb584931) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_550433

Preservative

Lyophilized powder

AA Sequence

GWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD1 Antibody
8G105-AAT 50 µg

FZD1 Antibody

Sign In for Pricing
View Details
Human KIAA1522 activation kit by CRISPRa
GA111658 1 Kit

Human KIAA1522 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CLDN18.2/Claudin-18 A2 Protein (His Tag)
PKSH033470-01 10 µg

Recombinant Human CLDN18.2/Claudin-18 A2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CLDN18.2/Claudin-18 A2 Protein (His Tag)
PKSH033470-02 50 µg

Recombinant Human CLDN18.2/Claudin-18 A2 Protein (His Tag)

Sign In for Pricing
View Details
Desfluorobutyrophenone 9 Oxo- Lumateperone
TRC-D284350-10MG 10 mg

Desfluorobutyrophenone 9 Oxo- Lumateperone

Sign In for Pricing
View Details
Bisphenol AP-d5
TRC-B519488-1MG 1 mg

Bisphenol AP-d5

Sign In for Pricing
View Details