Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urgcp Peptide - N-terminal region

Urgcp Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010005J08Rik, 9130001I21Rik, AW060359, Urg4, mKIAA1507, RP23-385C16.7

UniProt

Q5NCI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Urgcp Rabbit Polyclonal Antibody (orb326092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001071129

Preservative

Lyophilized powder

AA Sequence

YGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQKLTLQDSLQISFDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL 19 Protein
orb426469-01 2 µg

Mouse IL 19 Protein

Sign In for Pricing
View Details
Mouse IL 19 Protein
orb426469-02 10 µg

Mouse IL 19 Protein

Sign In for Pricing
View Details
Mouse IL 19 Protein
orb426469-03 1 mg

Mouse IL 19 Protein

Sign In for Pricing
View Details
MIR6863 Human qPCR Template Standard (MI0022710)
HK301466 200 Reactions

MIR6863 Human qPCR Template Standard (MI0022710)

Sign In for Pricing
View Details
OLIG1, CT (OLIG1, BHLHB6, BHLHE21, Oligodendrocyte transcription factor 1, Class B basic helix-loop-helix protein 6, Class E basic helix-loop-helix protein 21) (MaxLight 490)
MBS6327750-01 0.1 mL

OLIG1, CT (OLIG1, BHLHB6, BHLHE21, Oligodendrocyte transcription factor 1, Class B basic helix-loop-helix protein 6, Class E basic helix-loop-helix protein 21) (MaxLight 490)

Sign In for Pricing
View Details
OLIG1, CT (OLIG1, BHLHB6, BHLHE21, Oligodendrocyte transcription factor 1, Class B basic helix-loop-helix protein 6, Class E basic helix-loop-helix protein 21) (MaxLight 490)
MBS6327750-02 5x 0.1 mL

OLIG1, CT (OLIG1, BHLHB6, BHLHE21, Oligodendrocyte transcription factor 1, Class B basic helix-loop-helix protein 6, Class E basic helix-loop-helix protein 21) (MaxLight 490)

Sign In for Pricing
View Details