Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urgcp Peptide - N-terminal region

Urgcp Peptide - N-terminal region

Product Specifications

Product Name Alternative

2010005J08Rik, 9130001I21Rik, AW060359, Urg4, mKIAA1507, RP23-385C16.7

UniProt

Q5NCI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Urgcp Rabbit Polyclonal Antibody (orb326092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001071129

Preservative

Lyophilized powder

AA Sequence

YGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQKLTLQDSLQISFDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp428 3'UTR Lenti-reporter-Luc Vector
50972086 1.0 µg

Zfp428 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Upstream Binding Protein 1 Polyclonal Antibody
BS65961-01 50 µL

Upstream Binding Protein 1 Polyclonal Antibody

Sign In for Pricing
View Details
Upstream Binding Protein 1 Polyclonal Antibody
BS65961-02 100 µL

Upstream Binding Protein 1 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal PDCD4 Antibody (4C2) [PerCP]
NBP3-18224PCP 0.1 mL

Mouse Monoclonal PDCD4 Antibody (4C2) [PerCP]

Sign In for Pricing
View Details
Picalm (BC025566) Mouse Tagged ORF Clone
MR209390 10 µg

Picalm (BC025566) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BC024659 sgRNA CRISPR Lentivector set (Mouse)
K3260301 3x 1.0 µg

BC024659 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details