Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP15 Peptide - C-terminal region

USP15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0529, MGC131982, MGC149838, MGC74854, UNPH4, UNPH-2

UniProt

Q9Y4E8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP15 Rabbit Polyclonal Antibody (orb331033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IF, WB

NCBI Accession Number

NP_006304

Preservative

Lyophilized powder

AA Sequence

GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OTUB2 Protein
CRP2047-01 10 µg

Recombinant Human OTUB2 Protein

Sign In for Pricing
View Details
Recombinant Human OTUB2 Protein
CRP2047-02 50 µg

Recombinant Human OTUB2 Protein

Sign In for Pricing
View Details
Recombinant Human OTUB2 Protein
CRP2047-03 500 µg

Recombinant Human OTUB2 Protein

Sign In for Pricing
View Details
IL-4I1 Rabbit Polyclonal Antibody
MBS9512396-01 0.05 mL

IL-4I1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL-4I1 Rabbit Polyclonal Antibody
MBS9512396-02 0.1 mL

IL-4I1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL-4I1 Rabbit Polyclonal Antibody
MBS9512396-03 5x 0.1 mL

IL-4I1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details