Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP2 Peptide - middle region

USP2 Peptide - middle region

Product Specifications

Product Name Alternative

UBP41, USP9

UniProt

O75604

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP2 Rabbit Polyclonal Antibody (orb584295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004196

Preservative

Lyophilized powder

AA Sequence

NEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit
MBS9340303-01 48 Well

Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit

Sign In for Pricing
View Details
Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit
MBS9340303-02 96 Well

Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit

Sign In for Pricing
View Details
Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit
MBS9340303-03 5x 96 Well

Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit

Sign In for Pricing
View Details
Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit
MBS9340303-04 10x 96 Well

Mouse Putative zinc finger CCHC domain-containing protein 18, ZCCHC18 ELISA Kit

Sign In for Pricing
View Details
SMARCB1 Rabbit Polyclonal Antibody (PerCP)
orb1598447 100 µL

SMARCB1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
MITF Rabbit Polyclonal Antibody (HRP)
orb2129783 100 µL

MITF Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details