Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP2 Peptide - middle region

USP2 Peptide - middle region

Product Specifications

Product Name Alternative

UBP41, USP9

UniProt

O75604

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP2 Rabbit Polyclonal Antibody (orb584295) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004196

Preservative

Lyophilized powder

AA Sequence

NEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC36A1 Rabbit Polyclonal Antibody (PerCP)
orb2455631 100 µL

SLC36A1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
RAB9 Rabbit Polyclonal Antibody (BF647)
orb2402773 100 µL

RAB9 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
CD244
CSB-CL861192HU 10 μg Plasmid + 200 μL Glycerol

CD244

Sign In for Pricing
View Details
A2-Macroglobulin (A2M, alpha 2M, CPAMD5, DKFZp779B086, FWP007, S863-7) (MaxLight 490) discontinued
M1150-01-ML490 100 µL

A2-Macroglobulin (A2M, alpha 2M, CPAMD5, DKFZp779B086, FWP007, S863-7) (MaxLight 490) discontinued

Sign In for Pricing
View Details
E2F1 Protein (N-His, Human)
P503421 100 µg

E2F1 Protein (N-His, Human)

Sign In for Pricing
View Details
Anti-SETD5 Antibody Picoband®
A10168 100 µg/Vial

Anti-SETD5 Antibody Picoband®

Sign In for Pricing
View Details