Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp27x Peptide - middle region

Usp27x Peptide - middle region

Product Specifications

Product Name Alternative

Sfc11, Usp27

UniProt

Q8CEG8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Usp27x Rabbit Polyclonal Antibody (orb583969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062334

Preservative

Lyophilized powder

AA Sequence

CIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD61, clone 2f2 Antibody
orb1087989 7 mL

Mouse CD61, clone 2f2 Antibody

Sign In for Pricing
View Details
RNase H1 (RNASEH1) (NM_002936) Human Over-expression Lysate
LH19342V 100 µg

RNase H1 (RNASEH1) (NM_002936) Human Over-expression Lysate

Sign In for Pricing
View Details
ADORA3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0051503 1.0 µg DNA

ADORA3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AADACL1 (NCEH1) (NM_001146277) Human Tagged ORF Clone
RC228796 10 µg

AADACL1 (NCEH1) (NM_001146277) Human Tagged ORF Clone

Sign In for Pricing
View Details
Corynecin IV
C187-5MG 5 mg

Corynecin IV

Sign In for Pricing
View Details
CDH16 CRISPR All-in-one AAV vector set (with saCas9)(Human)
15657151 3x 1.0 µg DNA

CDH16 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details