Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp27x Peptide - middle region

Usp27x Peptide - middle region

Product Specifications

Product Name Alternative

Sfc11, Usp27

UniProt

Q8CEG8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Usp27x Rabbit Polyclonal Antibody (orb583969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062334

Preservative

Lyophilized powder

AA Sequence

CIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSC1 Antibody
MBS7128845-01 0.05 mL

DSC1 Antibody

Sign In for Pricing
View Details
DSC1 Antibody
MBS7128845-02 0.1 mL

DSC1 Antibody

Sign In for Pricing
View Details
DSC1 Antibody
MBS7128845-03 5x 0.1 mL

DSC1 Antibody

Sign In for Pricing
View Details
USP39 Rabbit mAb
E38A4109-01 100 µL

USP39 Rabbit mAb

Sign In for Pricing
View Details
USP39 Rabbit mAb
E38A4109-02 100 µg -100 µL

USP39 Rabbit mAb

Sign In for Pricing
View Details
Spag11b (NM_001037850) Rat Tagged Lenti ORF Clone
RR200015L3 10 µg

Spag11b (NM_001037850) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details