Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP30 Peptide - middle region

USP30 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ40511, MGC10702

UniProt

Q70CQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP30 Rabbit Polyclonal Antibody (orb580976) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116052

Preservative

Lyophilized powder

AA Sequence

SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEATR7A Rabbit pAb, IRDye 800CW conjugated
orb2841981 100 µL

HEATR7A Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Rat Monoclonal Mer Antibody (3D07) [CoraFluor 1]
NB110-94148CL1 0.1 mL

Rat Monoclonal Mer Antibody (3D07) [CoraFluor 1]

Sign In for Pricing
View Details
LAMP2A (F1A5A) Rabbit Monoclonal Antibody
CST 81197S 100 µL

LAMP2A (F1A5A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Coagulation Factor VII (F7) Polyclonal Antibody
CAU31486-01 100 µL

Coagulation Factor VII (F7) Polyclonal Antibody

Sign In for Pricing
View Details
Coagulation Factor VII (F7) Polyclonal Antibody
CAU31486-02 200 µL

Coagulation Factor VII (F7) Polyclonal Antibody

Sign In for Pricing
View Details
Coagulation Factor VII (F7) Polyclonal Antibody
CAU31486-03 1 mL

Coagulation Factor VII (F7) Polyclonal Antibody

Sign In for Pricing
View Details