Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP30 Peptide - middle region

USP30 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ40511, MGC10702

UniProt

Q70CQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP30 Rabbit Polyclonal Antibody (orb580976) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116052

Preservative

Lyophilized powder

AA Sequence

SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIFC1 (NM_002263) Human Tagged Lenti ORF Clone
RC215326L2 10 µg

KIFC1 (NM_002263) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RABGAP1L Protein Vector (Rat) (pPB-C-His)
PV297898 500 ng

RABGAP1L Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
SVOPL Double Nickase Plasmid (m)
sc-435790-NIC 20 µg

SVOPL Double Nickase Plasmid (m)

Sign In for Pricing
View Details
NBTI 5463
T210605-01 10 mg

NBTI 5463

Sign In for Pricing
View Details
NBTI 5463
T210605-02 50 mg

NBTI 5463

Sign In for Pricing
View Details
Recombinant Rat HACL1 Protein, His (Fc)-Avi-tagged
HACL1-2434R 50 µg

Recombinant Rat HACL1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details