Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UST Peptide - N-terminal region

UST Peptide - N-terminal region

Product Specifications

Product Name Alternative

2OST

UniProt

Q9Y2C2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UST Rabbit Polyclonal Antibody (orb325287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005706

Preservative

Lyophilized powder

AA Sequence

PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostaglandin D2
TRC-P838575-1MG 1 mg

Prostaglandin D2

Sign In for Pricing
View Details
CD8 (C8/468 + C8/144B), Biotin conjugate, 0.1mg/mL
BNCB0750-100 1x 100 µL

CD8 (C8/468 + C8/144B), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Bromo-4-isopropylaniline
TRC-B392010-25G 25 g

2-Bromo-4-isopropylaniline

Sign In for Pricing
View Details
FITC Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103C-01 50 Tests

FITC Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
FITC Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103C-02 100 Tests

FITC Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
FITC Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103C-03 2x 100 Tests

FITC Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details