Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UST Peptide - N-terminal region

UST Peptide - N-terminal region

Product Specifications

Product Name Alternative

2OST

UniProt

Q9Y2C2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UST Rabbit Polyclonal Antibody (orb325287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005706

Preservative

Lyophilized powder

AA Sequence

PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf62 Mouse Monoclonal Antibody [Clone ID: OTI5B5]
CF808848 100 µg

C21orf62 Mouse Monoclonal Antibody [Clone ID: OTI5B5]

Sign In for Pricing
View Details
Prezalumab Biosimilar - Research Grade
ICH5214-1mg 1 mg

Prezalumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF647 conjugate, 0.1mg/mL
BNC471424-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse MMP-3, Tag Free
HA211280-01 20 µg

Mouse MMP-3, Tag Free

Sign In for Pricing
View Details
Mouse MMP-3, Tag Free
HA211280-02 50 µg

Mouse MMP-3, Tag Free

Sign In for Pricing
View Details
Mouse MMP-3, Tag Free
HA211280-03 100 µg

Mouse MMP-3, Tag Free

Sign In for Pricing
View Details