Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP18 Peptide - N-terminal region

UTP18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGI-48, WDR50

UniProt

Q9Y5J1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IHC, WB

NCBI Accession Number

NP_057085

Preservative

Lyophilized powder

AA Sequence

PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Optitrol NAT CMV
NT02021 5x 1.2 mL

Optitrol NAT CMV

Sign In for Pricing
View Details
2,3-Diamino-4-chloropyridine
TRC-D415090-500MG 500 mg

2,3-Diamino-4-chloropyridine

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF640R conjugate, 0.1mg/mL
BNC402746-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L1 (CD274) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13G7]
TA809809AM 100 µL

PD-L1 (CD274) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13G7]

Sign In for Pricing
View Details
Texas Red Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-
T-1802-2 2 mg

Texas Red Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-

Sign In for Pricing
View Details
Colloidal Gold Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-, 1mL 10nm
GP-4601-10 1 mL

Colloidal Gold Conjugated Vicia villosa Lectin (Hairy Vetch) -VVA-, 1mL 10nm

Sign In for Pricing
View Details