Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP18 Peptide - N-terminal region

UTP18 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGI-48, WDR50

UniProt

Q9Y5J1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IHC, WB

NCBI Accession Number

NP_057085

Preservative

Lyophilized powder

AA Sequence

PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), 0.2mg/mL
BNUB1729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), 0.2mg/mL

Sign In for Pricing
View Details
MAPT / TAU Rabbit Polyclonal Antibody
AP06346PU-N 100 µg

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA501418AM 100 µL

Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
Mouse Gjb6 activation kit by CRISPRa
GA201622 1 Kit

Mouse Gjb6 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Esophagus
CS506449 5x 5 µm

Frozen Tissue Sections, Esophagus

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2784), CF568 conjugate, 0.1mg/mL
BNC682784-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2784), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details