UTS2R Peptide - C-terminal region
UTS2R Peptide - C-terminal region
Product Specifications
Product Name Alternative
GPR14, UTR, UTR2, UR-2-R
UniProt
Q9UKP6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UTS2R Rabbit Polyclonal Antibody (orb585689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061822
Preservative
Lyophilized powder
AA Sequence
WGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6458559-01 0.1 mL
Ptk7 (Inactive Tyrosine-Protein Kinase 7, Protein Chuzhoi, Protein-Tyrosine Kinase 7, Pseudo Tyrosine Kinase Receptor 7, Tyrosine-Protein Kinase-like 7, Ptk7) (PE)
Sign In for Pricing
View Details MBS6458559-02 5x 0.1 mL
Ptk7 (Inactive Tyrosine-Protein Kinase 7, Protein Chuzhoi, Protein-Tyrosine Kinase 7, Pseudo Tyrosine Kinase Receptor 7, Tyrosine-Protein Kinase-like 7, Ptk7) (PE)
Sign In for Pricing
View Details MBS6364934-01 0.2 mL
ZCCHC8, CT (ZCCHC8, Zinc finger CCHC domain-containing protein 8) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6364934-02 5x 0.2 mL
ZCCHC8, CT (ZCCHC8, Zinc finger CCHC domain-containing protein 8) (Azide free) (HRP)
Sign In for Pricing
View Details 
21994064 1.0 µg DNA
Gm362 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details