Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTS2R Peptide - C-terminal region

UTS2R Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR14, UTR, UTR2, UR-2-R

UniProt

Q9UKP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UTS2R Rabbit Polyclonal Antibody (orb585689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061822

Preservative

Lyophilized powder

AA Sequence

WGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEnCMV-PRDX1-3×FLAG-SV40-Neo Plasmid
PVT40652 2 µg

pEnCMV-PRDX1-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
IL-1 beta Antibody
5128-100 100 µg

IL-1 beta Antibody

Sign In for Pricing
View Details
ARL2BP, 1-163aa, Human, His tag, E.coli
E53A01223 50 µg

ARL2BP, 1-163aa, Human, His tag, E.coli

Sign In for Pricing
View Details
C86695 Protein Vector (Mouse) (pPM-C-His)
PV160613 500 ng

C86695 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Aida (NM_181732) Mouse Recombinant Protein
PM47447M5 20 µg

Aida (NM_181732) Mouse Recombinant Protein

Sign In for Pricing
View Details
IQGAP1 (D-3) Alexa Fluor® 647
sc-374307 AF647 200 µg/mL

IQGAP1 (D-3) Alexa Fluor® 647

Sign In for Pricing
View Details