Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAC14 Peptide - C-terminal region

VAC14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ArPIKfyve, FLJ10305, FLJ36622, FLJ46582, MGC149815, MGC149816, TAX1BP2, TRX

UniProt

Q08AM6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VAC14 Rabbit Polyclonal Antibody (orb585094) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060522

Preservative

Lyophilized powder

AA Sequence

QLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXC6 (NM_153693) Human Over-expression Lysate
LY403515 100 µg

HOXC6 (NM_153693) Human Over-expression Lysate

Sign In for Pricing
View Details
9-cis-5,6-Epoxy-5,6-dihydro-retinoic Acid
TRC-E589810-5MG 5 mg

9-cis-5,6-Epoxy-5,6-dihydro-retinoic Acid

Sign In for Pricing
View Details
ATP5PD (NM_006356) Human Recombinant Protein
TP307908L 1 mg

ATP5PD (NM_006356) Human Recombinant Protein

Sign In for Pricing
View Details
SDS3 (SUDS3) (NM_022491) Human Over-expression Lysate
LC402929 20 µg

SDS3 (SUDS3) (NM_022491) Human Over-expression Lysate

Sign In for Pricing
View Details
Succinic Acid-1,4-13C2
TRC-S688768-5MG 5 mg

Succinic Acid-1,4-13C2

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1086-01 50 μL

DNAJB6 Antibody

Sign In for Pricing
View Details