Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAC14 Peptide - C-terminal region

VAC14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ArPIKfyve, FLJ10305, FLJ36622, FLJ46582, MGC149815, MGC149816, TAX1BP2, TRX

UniProt

Q08AM6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VAC14 Rabbit Polyclonal Antibody (orb585094) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060522

Preservative

Lyophilized powder

AA Sequence

QLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rhob activation kit by CRISPRa
GA200273 1 Kit

Mouse Rhob activation kit by CRISPRa

Sign In for Pricing
View Details
Transmembrane protein 132A Rabbit Polyclonal Antibody
0903-8 100 µL

Transmembrane protein 132A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR2AP1 Antibody
8G435-AAT 50 µg

OR2AP1 Antibody

Sign In for Pricing
View Details
CD45RB (PTPRC/1147), CF647 conjugate, 0.1mg/mL
BNC471147-100 1x 100 µL

CD45RB (PTPRC/1147), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS501413 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
DL-Leucyl-glycine
TRC-L113520-1MG 1 mg

DL-Leucyl-glycine

Sign In for Pricing
View Details