Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp1 Peptide - middle region

Vamp1 Peptide - middle region

Product Specifications

Product Name Alternative

Syb1

UniProt

Q63666

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vamp1 Rabbit Polyclonal Antibody (orb584353) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037222

Preservative

Lyophilized powder

AA Sequence

DKVLERDQKLSELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HSF1 Protein, His Tag
E40KMPH3531 20 µg

Human HSF1 Protein, His Tag

Sign In for Pricing
View Details
OXSM Antibody - middle region (ARP86691_P050)
ARP86691_P050 100 µL

OXSM Antibody - middle region (ARP86691_P050)

Sign In for Pricing
View Details
Anti-Human C-Reactive Protein (CRP), Biotin, (Polyclonal), (Rabbit IgG)
MBS524157-01 0.1 mg

Anti-Human C-Reactive Protein (CRP), Biotin, (Polyclonal), (Rabbit IgG)

Sign In for Pricing
View Details
Anti-Human C-Reactive Protein (CRP), Biotin, (Polyclonal), (Rabbit IgG)
MBS524157-02 5x 0.1 mg

Anti-Human C-Reactive Protein (CRP), Biotin, (Polyclonal), (Rabbit IgG)

Sign In for Pricing
View Details
RALY Rabbit Polyclonal Antibody (FITC)
orb2137775 100 µL

RALY Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rat Wingless Type MMTV IntegRation Site Family, Member 2 (WNT2) ELISA Kit
201-11-1221 96 Tests

Rat Wingless Type MMTV IntegRation Site Family, Member 2 (WNT2) ELISA Kit

Sign In for Pricing
View Details