Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp1 Peptide - C-terminal region

Vamp1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Syb1

UniProt

Q63666

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vamp1 Rabbit Polyclonal Antibody (orb584354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037222

Preservative

Lyophilized powder

AA Sequence

ELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neptune Filter Tips 20-300 µL Universal Fit Racked, Low Retention, Pre-Sterilized
BT300 96 Tips/Rack - 10 Racks/PK

Neptune Filter Tips 20-300 µL Universal Fit Racked, Low Retention, Pre-Sterilized

Sign In for Pricing
View Details
ARL5A Human qPCR Primer Pair (NM_012097)
HP228499 200 Reactions

ARL5A Human qPCR Primer Pair (NM_012097)

Sign In for Pricing
View Details
BAG5 (NM_001015048) Human Recombinant Protein
TP312765M 100 µg

BAG5 (NM_001015048) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant ERR alpha Antibody
RC-6898-01 50 μL

Recombinant ERR alpha Antibody

Sign In for Pricing
View Details
Recombinant ERR alpha Antibody
RC-6898-02 100 µL

Recombinant ERR alpha Antibody

Sign In for Pricing
View Details
Recombinant ERR alpha Antibody
RC-6898-03 1 mL

Recombinant ERR alpha Antibody

Sign In for Pricing
View Details