Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp7 Peptide - C-terminal region

Vamp7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Sybl1, TI-VAMP, VAMP-7

UniProt

P70280

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vamp7 Rabbit Polyclonal Antibody (orb580122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035645

Preservative

Lyophilized powder

AA Sequence

DELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Calmodulin 1/2/3 (Ser102) Rabbit Polyclonal Antibody (PE)
orb506016 100 µL

Phospho-Calmodulin 1/2/3 (Ser102) Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Phospho-14-3-3 theta (Ser232) Rabbit Polyclonal Antibody (FITC)
orb191023 100 µL

Phospho-14-3-3 theta (Ser232) Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MAP1A Antibody
MBS7128230-01 0.05 mL

MAP1A Antibody

Sign In for Pricing
View Details
MAP1A Antibody
MBS7128230-02 0.1 mL

MAP1A Antibody

Sign In for Pricing
View Details
MAP1A Antibody
MBS7128230-03 5x 0.1 mL

MAP1A Antibody

Sign In for Pricing
View Details
M-PEG8-Ms
M33420-01 1 g

M-PEG8-Ms

Sign In for Pricing
View Details