Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vamp7 Peptide - C-terminal region

Vamp7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Sybl1, TI-VAMP, VAMP-7

UniProt

P70280

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vamp7 Rabbit Polyclonal Antibody (orb580122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035645

Preservative

Lyophilized powder

AA Sequence

DELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-UBE2H Antibody Picoband® Cy3 Conjugated
A10471-1-Cy3 100 µg/Vial

Anti-UBE2H Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Sry Antibody, HRP conjugated
A35658-100UG 100 µg

Sry Antibody, HRP conjugated

Sign In for Pricing
View Details
TORC2   rabbit pAb
UB-GEN-12353 100 µL

TORC2 rabbit pAb

Sign In for Pricing
View Details
CytoSinct™ CD14 Nanobeads, human
L00956-0.5 500 µL

CytoSinct™ CD14 Nanobeads, human

Sign In for Pricing
View Details
ECM1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
18898156 3x 1.0 µg DNA

ECM1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Caesium hexafluoroantimonate
PC1632 1 Each

Caesium hexafluoroantimonate

Sign In for Pricing
View Details