VARS2 Peptide - middle region
VARS2 Peptide - middle region
Product Specifications
Product Name Alternative
MGC138259, MGC142165, VARS2L, VARSL
UniProt
Q5ST30
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VARS2 Rabbit Polyclonal Antibody (orb580153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065175
Preservative
Lyophilized powder
AA Sequence
LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS689734-01 0.1 mg
Rabbit anti-S tag IgG,, primary antibody, Conjugated to Biotin
Sign In for Pricing
View Details MBS689734-02 5x 0.1 mg
Rabbit anti-S tag IgG,, primary antibody, Conjugated to Biotin
Sign In for Pricing
View Details A02239-1-Cy3 100 µg/Vial
Anti-UGT1A6 Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details 