Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VARS2 Peptide - middle region

VARS2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC138259, MGC142165, VARS2L, VARSL

UniProt

Q5ST30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VARS2 Rabbit Polyclonal Antibody (orb580153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065175

Preservative

Lyophilized powder

AA Sequence

LERRFSRVQEVVQVLRALRATYQLTKARPRVLLQSSEPGDQGLFEAFLEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 Antibody
orb344458 1 mg

AKT1 Antibody

Sign In for Pricing
View Details
Bovine Monocyte Chemotactic Protein 1 (MCP-1; CCL2) ELISA KIT
orb3012449-01 48 Tests

Bovine Monocyte Chemotactic Protein 1 (MCP-1; CCL2) ELISA KIT

Sign In for Pricing
View Details
Bovine Monocyte Chemotactic Protein 1 (MCP-1; CCL2) ELISA KIT
orb3012449-02 96 Tests

Bovine Monocyte Chemotactic Protein 1 (MCP-1; CCL2) ELISA KIT

Sign In for Pricing
View Details
Bovine Monocyte Chemotactic Protein 1 (MCP-1; CCL2) ELISA KIT
orb3012449-03 5 x 96 T

Bovine Monocyte Chemotactic Protein 1 (MCP-1; CCL2) ELISA KIT

Sign In for Pricing
View Details
Monoclonal Anti-human IA2 antibody.
TMI081-1MG 1 mg

Monoclonal Anti-human IA2 antibody.

Sign In for Pricing
View Details
Clusterin (Biotin)
546020 200 µL

Clusterin (Biotin)

Sign In for Pricing
View Details