Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VASP Peptide - C-terminal region

VASP Peptide - C-terminal region

Product Specifications

UniProt

P50552

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VASP Rabbit Polyclonal Antibody (orb331126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003361

Preservative

Lyophilized powder

AA Sequence

SGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPS-1 Microplate Platform
MIX0530 1 Each

MPS-1 Microplate Platform

Sign In for Pricing
View Details
Cupric sulphate (Copper sulphate)
3121840 1 Each

Cupric sulphate (Copper sulphate)

Sign In for Pricing
View Details
Fish free tri-iodothyronine,FT3 ELISA KIT
JOT-EKA0033FI 96 wells

Fish free tri-iodothyronine,FT3 ELISA KIT

Sign In for Pricing
View Details
RB-PEG-N3 (MW 10000)
orb3136384-01 10 mg

RB-PEG-N3 (MW 10000)

Sign In for Pricing
View Details
RB-PEG-N3 (MW 10000)
orb3136384-02 50 mg

RB-PEG-N3 (MW 10000)

Sign In for Pricing
View Details
Metaphit
B5009-50 50 mg

Metaphit

Sign In for Pricing
View Details