Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VASP Peptide - C-terminal region

VASP Peptide - C-terminal region

Product Specifications

UniProt

P50552

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VASP Rabbit Polyclonal Antibody (orb331126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003361

Preservative

Lyophilized powder

AA Sequence

SGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AZD-3759
9609-5 5 mg

AZD-3759

Sign In for Pricing
View Details
SERPINB9 Rabbit Polyclonal Antibody (HRP)
orb2587216 100 µg

SERPINB9 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
STING1 Antibody
orb1409997-01 20 µg

STING1 Antibody

Sign In for Pricing
View Details
STING1 Antibody
orb1409997-02 100 µg

STING1 Antibody

Sign In for Pricing
View Details
STING1 Antibody
orb1409997-03 100 ug (without BSA and Azide)

STING1 Antibody

Sign In for Pricing
View Details
Anti-Human CALD1 Polyclonal Antibody
PHG05601 100 μg

Anti-Human CALD1 Polyclonal Antibody

Sign In for Pricing
View Details