VASP Peptide - middle region
VASP Peptide - middle region
Product Specifications
UniProt
P50552
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VASP Rabbit Polyclonal Antibody (orb331127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003361
Preservative
Lyophilized powder
AA Sequence
WSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
N5375-26D-AP 200 µL
Notch3, CT (Notch Homolog 3 (Drosophila), hN3, Neurogenic Locus Notch Homolog Protein 3, CADASIL, CASIL) (AP) discontinued
Sign In for Pricing
View Details 
GTR15206091 1 Vial
Lentiviral mouse Haao shRNA (UAS) - Lentiviral mouse Haao shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
144966 100 µg
NGAL (Alpha-2-microglobulin-related protein, Alpha-2U globulin-related protein, Lipocalin-2, Siderocalin LCN2, p25) discontinued
Sign In for Pricing
View Details