Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAT1 Peptide - N-terminal region

VAT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20230, VATI

UniProt

Q99536

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VAT1 Rabbit Polyclonal Antibody (orb325723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006364

Preservative

Lyophilized powder

AA Sequence

PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAMP1 Antibody
KC-1781-01 50 μL

VAMP1 Antibody

Sign In for Pricing
View Details
VAMP1 Antibody
KC-1781-02 100 µL

VAMP1 Antibody

Sign In for Pricing
View Details
VAMP1 Antibody
KC-1781-03 1 mL

VAMP1 Antibody

Sign In for Pricing
View Details
Zomepirac Sodium Salt-d4
TRC-Z675002-100MG 100 mg

Zomepirac Sodium Salt-d4

Sign In for Pricing
View Details
Human STK22C (TSSK3) activation kit by CRISPRa
GA113104 1 Kit

Human STK22C (TSSK3) activation kit by CRISPRa

Sign In for Pricing
View Details
ADH6 (Center) Rabbit Polyclonal Antibody
AP50091PU-N 400 µL

ADH6 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details