Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAT1 Peptide - N-terminal region

VAT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20230, VATI

UniProt

Q99536

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VAT1 Rabbit Polyclonal Antibody (orb325723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006364

Preservative

Lyophilized powder

AA Sequence

PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUP214 Antibody
KC-45565-01 50 μL

NUP214 Antibody

Sign In for Pricing
View Details
NUP214 Antibody
KC-45565-02 100 µL

NUP214 Antibody

Sign In for Pricing
View Details
NUP214 Antibody
KC-45565-03 1 mL

NUP214 Antibody

Sign In for Pricing
View Details
TremL2 Mouse Gene Knockout Kit (CRISPR)
KN518165 1 Kit

TremL2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASNA1 Rabbit Polyclonal Antibody
HA500051 100 µL

ASNA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CD90/Thy1 Monoclonal Antibody
AN301747L-01 50 µL

Recombinant CD90/Thy1 Monoclonal Antibody

Sign In for Pricing
View Details