Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VCP Peptide - C-terminal region

VCP Peptide - C-terminal region

Product Specifications

Product Name Alternative

IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97, ALS14

UniProt

P55072

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IP, WB

NCBI Accession Number

NP_009057

Preservative

Lyophilized powder

AA Sequence

EMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Upp2 Antibody - C-terminal region
ARP49101_P050-25UL 25 µL

Upp2 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Human RING1 & YY1 Binding Protein
MBS144675-01 0.002 mg

Recombinant Human RING1 & YY1 Binding Protein

Sign In for Pricing
View Details
Recombinant Human RING1 & YY1 Binding Protein
MBS144675-02 0.01 mg

Recombinant Human RING1 & YY1 Binding Protein

Sign In for Pricing
View Details
Recombinant Human RING1 & YY1 Binding Protein
MBS144675-03 0.1 mg

Recombinant Human RING1 & YY1 Binding Protein

Sign In for Pricing
View Details
Recombinant Human RING1 & YY1 Binding Protein
MBS144675-04 5x 0.1 mg

Recombinant Human RING1 & YY1 Binding Protein

Sign In for Pricing
View Details
C7orf41 CRISPR Knock Out 293T Cell Line (Human)
14687141 1x 10^6 Cells / 1.0 mL

C7orf41 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details