Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VCP Peptide - C-terminal region

VCP Peptide - C-terminal region

Product Specifications

Product Name Alternative

IBMPFD, MGC131997, MGC148092, MGC8560, TERA, p97, ALS14

UniProt

P55072

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IP, WB

NCBI Accession Number

NP_009057

Preservative

Lyophilized powder

AA Sequence

EMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ugcg shRNA (UAS) - Lentiviral mouse Ugcg shRNA (UAS, GFP) plasmid
GTR15226342 1 Vial

Lentiviral mouse Ugcg shRNA (UAS) - Lentiviral mouse Ugcg shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Itgad sgRNA CRISPR Lentivector (Rat) (Target 3)
K7088404 1.0 µg DNA

Itgad sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: tibia, distal
CS711905 5x 5 µm

Tissue FFPE Sections, Bone: tibia, distal

Sign In for Pricing
View Details
WIF1
pro-684 2µg

WIF1

Sign In for Pricing
View Details
WDR73 (NM_032856) Human Recombinant Protein
TP309040 20 µg

WDR73 (NM_032856) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) pheS Polyclonal Antibody
MBS7179364 Inquire

Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) pheS Polyclonal Antibody

Sign In for Pricing
View Details