Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VDR Peptide - N-terminal region

VDR Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1I1

UniProt

P11473

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VDR Rabbit Polyclonal Antibody (orb329595) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000367

Preservative

Lyophilized powder

AA Sequence

LKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Vagina
CS509461 5x 5 µm

Frozen Tissue Sections, Vagina

Sign In for Pricing
View Details
Ultrapure Nuclease-Free Water - 100 x 1.25 mL
28002 100 Units

Ultrapure Nuclease-Free Water - 100 x 1.25 mL

Sign In for Pricing
View Details
Oct4 (POU5F1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9B7]
TA500035BM 100 µL

Oct4 (POU5F1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9B7]

Sign In for Pricing
View Details
2’-Deoxy-5-hydroxyuridine
TRC-D281525-5MG 5 mg

2’-Deoxy-5-hydroxyuridine

Sign In for Pricing
View Details
RWDD3 Mouse Monoclonal Antibody [Clone ID: OTI10H4]
CF811763 100 µg

RWDD3 Mouse Monoclonal Antibody [Clone ID: OTI10H4]

Sign In for Pricing
View Details
EMP2 (NM_001424) Human Over-expression Lysate
LC400553 20 µg

EMP2 (NM_001424) Human Over-expression Lysate

Sign In for Pricing
View Details