Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VDR Peptide - N-terminal region

VDR Peptide - N-terminal region

Product Specifications

Product Name Alternative

NR1I1

UniProt

P11473

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VDR Rabbit Polyclonal Antibody (orb329595) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000367

Preservative

Lyophilized powder

AA Sequence

LKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP22 Recombinant Rabbit Monoclonal Antibody [JM52-30]
ET1705-15 100 µL

PMP22 Recombinant Rabbit Monoclonal Antibody [JM52-30]

Sign In for Pricing
View Details
Cd3e Hamster Monoclonal Antibody [Clone ID: 145-2C11]
CL001P 250 µg

Cd3e Hamster Monoclonal Antibody [Clone ID: 145-2C11]

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF640R conjugate, 0.1mg/mL
BNC402702-500 1x 500 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ent-Kaurenoic Acid
TRC-K145660-25MG 25 mg

ent-Kaurenoic Acid

Sign In for Pricing
View Details
Grubbs Catalyst, 1st Generation
TRC-G789005-500MG 500 mg

Grubbs Catalyst, 1st Generation

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF405S conjugate, 0.1mg/mL
BNC041634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details