Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFB Peptide - middle region

VEGFB Peptide - middle region

Product Specifications

Product Name Alternative

VEGFL, VRF

UniProt

P49765

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VEGFB Rabbit Polyclonal Antibody (orb584183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003368

Preservative

Lyophilized powder

AA Sequence

PTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LSM1 protein
orb392098-01 10 µg

Human LSM1 protein

Sign In for Pricing
View Details
Human LSM1 protein
orb392098-02 50 µg

Human LSM1 protein

Sign In for Pricing
View Details
Human LSM1 protein
orb392098-03 500 µg

Human LSM1 protein

Sign In for Pricing
View Details
Rat PaRathyroid Hormone-Like Related Protein,PTHrP ELISA Kit
CN-01766R2 48T

Rat PaRathyroid Hormone-Like Related Protein,PTHrP ELISA Kit

Sign In for Pricing
View Details
Casein Kinase 1 Alpha 1 (CSNK1a1) Polyclonal Antibody
CAU27426-01 100 µL

Casein Kinase 1 Alpha 1 (CSNK1a1) Polyclonal Antibody

Sign In for Pricing
View Details
Casein Kinase 1 Alpha 1 (CSNK1a1) Polyclonal Antibody
CAU27426-02 200 µL

Casein Kinase 1 Alpha 1 (CSNK1a1) Polyclonal Antibody

Sign In for Pricing
View Details