Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGFB Peptide - middle region

VEGFB Peptide - middle region

Product Specifications

Product Name Alternative

VEGFL, VRF

UniProt

P49765

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VEGFB Rabbit Polyclonal Antibody (orb584183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003368

Preservative

Lyophilized powder

AA Sequence

PTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC16 Peptide - N-terminal region (AAP47137)
AAP47137-100UG 100 µg

DNAJC16 Peptide - N-terminal region (AAP47137)

Sign In for Pricing
View Details
Med9 Double Nickase Plasmid (h2)
sc-412442-NIC-2 20 µg

Med9 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Lambda Light Chain (Bence Jones Protein, BJP, IGLC 1/2/3, Mcg Marker, ParaProtein) (BSA & Azide Free) (MaxLight 405) discontinued
172120-AF-ML405 100 µL

Lambda Light Chain (Bence Jones Protein, BJP, IGLC 1/2/3, Mcg Marker, ParaProtein) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
InVivoMAb Anti-Human F8/Coagulation factor VIII Antibody (3E6#)
VHB86207 100 μg

InVivoMAb Anti-Human F8/Coagulation factor VIII Antibody (3E6#)

Sign In for Pricing
View Details
Nori® Canine 2-Plex ELISA Kits-MMP2/MMP10
GR226148 96 Well

Nori® Canine 2-Plex ELISA Kits-MMP2/MMP10

Sign In for Pricing
View Details
C3orf20 Antibody, HRP conjugated
CSB-PA818767LB01HU-01 50 µg

C3orf20 Antibody, HRP conjugated

Sign In for Pricing
View Details