Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll2 Peptide - C-terminal region

Vgll2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C130057C21Rik, VITO-1, Vito1

UniProt

Q8BGW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vgll2 Rabbit Polyclonal Antibody (orb576330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722481

Preservative

Lyophilized powder

AA Sequence

APASAPAPGSPPCELAAKGEPAGSAWAAPGGPFVSPTGDVAQSLGLSVDS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Zinc finger protein 892 (ZN892), Biotinylated
orb3008123-01 20 µg

Recombinant Human Zinc finger protein 892 (ZN892), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 892 (ZN892), Biotinylated
orb3008123-02 100 µg

Recombinant Human Zinc finger protein 892 (ZN892), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 892 (ZN892), Biotinylated
orb3008123-03 1 mg

Recombinant Human Zinc finger protein 892 (ZN892), Biotinylated

Sign In for Pricing
View Details
2-Butylpiperidine hydrochloride
OR903593-01 100 mg

2-Butylpiperidine hydrochloride

Sign In for Pricing
View Details
2-Butylpiperidine hydrochloride
OR903593-02 250 mg

2-Butylpiperidine hydrochloride

Sign In for Pricing
View Details
2-Butylpiperidine hydrochloride
OR903593-03 1 g

2-Butylpiperidine hydrochloride

Sign In for Pricing
View Details