Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VHL Peptide - N-terminal region

VHL Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRCA1, RCA1, VHL1, pVHL

UniProt

P40337

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VHL Rabbit Polyclonal Antibody (orb584314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_937799

Preservative

Lyophilized powder

AA Sequence

EDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLL4 Rabbit pAb
A24862-01 20 µL

DLL4 Rabbit pAb

Sign In for Pricing
View Details
DLL4 Rabbit pAb
A24862-02 100 μL

DLL4 Rabbit pAb

Sign In for Pricing
View Details
DLL4 Rabbit pAb
A24862-03 500 μL

DLL4 Rabbit pAb

Sign In for Pricing
View Details
DLL4 Rabbit pAb
A24862-04 1000 μL

DLL4 Rabbit pAb

Sign In for Pricing
View Details
Human CD327 Protein (Gln 16-Val 320) [Fc]
VAng-2722Lsx-100g 100 µg

Human CD327 Protein (Gln 16-Val 320) [Fc]

Sign In for Pricing
View Details
KRV-VP1 + KRV-VP2 (C-terminus) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-4642R-BF750-01 20 µL

KRV-VP1 + KRV-VP2 (C-terminus) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details