Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VHL Peptide - N-terminal region

VHL Peptide - N-terminal region

Product Specifications

Product Name Alternative

HRCA1, RCA1, VHL1, pVHL

UniProt

P40337

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VHL Rabbit Polyclonal Antibody (orb584314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_937799

Preservative

Lyophilized powder

AA Sequence

EDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttc13 (NM_145607) Mouse Tagged ORF Clone
MG221244 10 µg

Ttc13 (NM_145607) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Monoclonal Antibody to Haptoglobin Related Protein (HPR)
TRV-0049978-01 20 µL

Monoclonal Antibody to Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details
Monoclonal Antibody to Haptoglobin Related Protein (HPR)
TRV-0049978-02 100 µL

Monoclonal Antibody to Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details
Monoclonal Antibody to Haptoglobin Related Protein (HPR)
TRV-0049978-03 200 µL

Monoclonal Antibody to Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details
Monoclonal Antibody to Haptoglobin Related Protein (HPR)
TRV-0049978-04 1 mL

Monoclonal Antibody to Haptoglobin Related Protein (HPR)

Sign In for Pricing
View Details
CDH17 Antibody
orb672410-01 50 µg

CDH17 Antibody

Sign In for Pricing
View Details