VIP Peptide - middle region
VIP Peptide - middle region
Product Specifications
Product Name Alternative
MGC13587, PHM27
UniProt
P01282
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VIP Rabbit Polyclonal Antibody (orb579473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003372
Preservative
Lyophilized powder
AA Sequence
VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx253504-01 96 Tests
Human Platelet Derived Growth Factor C (PDGFC) ELISA Kit
Sign In for Pricing
View Details abx253504-02 5x 96 Tests
Human Platelet Derived Growth Factor C (PDGFC) ELISA Kit
Sign In for Pricing
View Details 
abx253504-03 10x 96 Tests
Human Platelet Derived Growth Factor C (PDGFC) ELISA Kit
Sign In for Pricing
View Details 
abx001669-02 100 µL
Prostate-Specific Antigen / PSA (KLK3) Antibody
Sign In for Pricing
View Details abx001669-03 2x 100 µL
Prostate-Specific Antigen / PSA (KLK3) Antibody
Sign In for Pricing
View Details