VIP Peptide - middle region
VIP Peptide - middle region
Product Specifications
Product Name Alternative
MGC13587, PHM27
UniProt
P01282
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VIP Rabbit Polyclonal Antibody (orb579473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003372
Preservative
Lyophilized powder
AA Sequence
VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1184031-01 25 Tests
Human CD71 Mouse Monoclonal Antibody (PE-Cy7)
Sign In for Pricing
View Details orb1184031-02 50 Tests
Human CD71 Mouse Monoclonal Antibody (PE-Cy7)
Sign In for Pricing
View Details 
orb1184031-03 100 Tests
Human CD71 Mouse Monoclonal Antibody (PE-Cy7)
Sign In for Pricing
View Details MBS7055833 Inquire
Recombinant Debaryomyces hansenii Cytochrome c oxidase subunit 2 (COX2), partial
Sign In for Pricing
View Details