Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VNN2 Peptide - C-terminal region

VNN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FOAP-4, GPI-80

UniProt

O95498

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VNN2 Rabbit Polyclonal Antibody (orb585124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004656

Preservative

Lyophilized powder

AA Sequence

FRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit GMP synthase Antibody
orb1526664-01 10 µL

Rabbit GMP synthase Antibody

Sign In for Pricing
View Details
Rabbit GMP synthase Antibody
orb1526664-02 100 µL

Rabbit GMP synthase Antibody

Sign In for Pricing
View Details
GRM3 Rabbit Polyclonal Antibody
E10G07327 100 µL

GRM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OSR2 Blocking Peptide
MBS9624841-01 1 mg

OSR2 Blocking Peptide

Sign In for Pricing
View Details
OSR2 Blocking Peptide
MBS9624841-02 5x 1 mg

OSR2 Blocking Peptide

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ZAT11 Polyclonal Antibody
MBS9013163 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ZAT11 Polyclonal Antibody

Sign In for Pricing
View Details