Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VNN2 Peptide - C-terminal region

VNN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FOAP-4, GPI-80

UniProt

O95498

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VNN2 Rabbit Polyclonal Antibody (orb585124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004656

Preservative

Lyophilized powder

AA Sequence

FRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAT3 siRNA (Mouse)
MBS8234732-01 15 nmol

ADAT3 siRNA (Mouse)

Sign In for Pricing
View Details
ADAT3 siRNA (Mouse)
MBS8234732-02 30 nmol

ADAT3 siRNA (Mouse)

Sign In for Pricing
View Details
ADAT3 siRNA (Mouse)
MBS8234732-03 5x 30 nmol

ADAT3 siRNA (Mouse)

Sign In for Pricing
View Details
FAM162A AAV Vector (Rat) (CMV)
19815106 1 µg

FAM162A AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SLC39A13 Protein Vector (Rat) (pPB-C-His)
PV306078 500 ng

SLC39A13 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
PITPNM1 Antibody
59-059 400 µL

PITPNM1 Antibody

Sign In for Pricing
View Details