Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VNN3 Peptide - N-terminal region

VNN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSA238982, MGC171203

UniProt

Q9NY84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060869

Preservative

Lyophilized powder

AA Sequence

VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS704877 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS705745 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB629190 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
Caspase 2 (CASP2) (NM_032982) Human Recombinant Protein
TP760618 50 µg

Caspase 2 (CASP2) (NM_032982) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Appendix
CS500209 5x 5 µm

Frozen Tissue Sections, Appendix

Sign In for Pricing
View Details
SETD2 Human Gene Knockout Kit (CRISPR)
KN224760RB 1 Kit

SETD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details