Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VNN3 Peptide - N-terminal region

VNN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSA238982, MGC171203

UniProt

Q9NY84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060869

Preservative

Lyophilized powder

AA Sequence

VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decyl Maltose Neopentyl Glycol
TRC-D525770-250MG 250 mg

Decyl Maltose Neopentyl Glycol

Sign In for Pricing
View Details
STAU2 (NM_001164384) Human Over-expression Lysate
LC431953 20 µg

STAU2 (NM_001164384) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-01 20 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-02 100 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PE Anti-Human CD45 Antibody[HI30]
E-AB-F1137D-03 2x 100 Tests

PE Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), CF594 conjugate, 0.1mg/mL
BNC940800-100 1x 100 µL

Cytokeratin 19 (KRT19/800), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details