Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS16 Peptide - N-terminal region

VPS16 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HVPS16

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VPS16 Rabbit Polyclonal Antibody (orb330938) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_536339

Preservative

Lyophilized powder

AA Sequence

RGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycocholic Acid Sodium Salt
TRC-G641368-1G 1 g

Glycocholic Acid Sodium Salt

Sign In for Pricing
View Details
DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)
KN401759 1 Kit

DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSD95 (DLG4) Mouse Monoclonal Antibody [Clone ID: OTI12A5]
CF809015 100 µg

PSD95 (DLG4) Mouse Monoclonal Antibody [Clone ID: OTI12A5]

Sign In for Pricing
View Details
PAX7 (NM_001135254) Human Over-expression Lysate
LY427610 100 µg

PAX7 (NM_001135254) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C-Terminal Binding Protein 2 (CTBP2) ELISA Kit
RD-CTBP2-Hu-01 96 Tests

Human C-Terminal Binding Protein 2 (CTBP2) ELISA Kit

Sign In for Pricing
View Details
Human C-Terminal Binding Protein 2 (CTBP2) ELISA Kit
RD-CTBP2-Hu-02 48 Tests

Human C-Terminal Binding Protein 2 (CTBP2) ELISA Kit

Sign In for Pricing
View Details